PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01295.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 334aa    MW: 37851.5 Da    PI: 6.679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01295.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49.5e-201461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEde+lv++v+++G  +W++ +++ g++R++k+c++rw +yl
  Rsa1.0_01295.1_g00009.1 14 KGPWTPEEDEKLVNYVQKHGHSSWTALPKRAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding56.18.4e-1867112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rgr+++eE++ ++++++ lG++ W+tIa+ ++ gRt++++k++w+++l
  Rsa1.0_01295.1_g00009.1  67 RGRFSPEEEQTILNLHAVLGNK-WSTIANNLP-GRTDNEIKNFWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25664IPR009057Homeodomain-like
PROSITE profilePS5129418.945961IPR017930Myb domain
SuperFamilySSF466897.86E-3211108IPR009057Homeodomain-like
SMARTSM007174.2E-161363IPR001005SANT/Myb domain
PfamPF002492.0E-181461IPR001005SANT/Myb domain
CDDcd001674.71E-131661No hitNo description
PROSITE profilePS5129426.46662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2865117IPR009057Homeodomain-like
SMARTSM007173.7E-1666114IPR001005SANT/Myb domain
PfamPF002497.8E-1667112IPR001005SANT/Myb domain
CDDcd001673.28E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MRRSLCSDDS GLKKGPWTPE EDEKLVNYVQ KHGHSSWTAL PKRAGLNRCG KSCRLRWTNY  60
LRPDIKRGRF SPEEEQTILN LHAVLGNKWS TIANNLPGRT DNEIKNFWNT HLKKKMIQMG  120
IDPMTHRPRP DVFSSLSQLL SMSSNLRGFV DMQLQFQTDQ EQTILKLQTE MAKLKLLQYL  180
LQPPSMNNNI NPNDLDTPSL LNTISSFKET NTTSNNLDHG SYLQDFNNIP SLIGPSSVFP  240
QHLEDSHFKF FTQRENLPVS PVWLSDPSSS NQSLVPSLDP SSAVSDDDLI RNHYIIEDVN  300
SNLMSSSSRQ ESGASASAVW PDHLLDDSIF SNIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681915.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP09e-69MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A078CQL90.0A0A078CQL9_BRANA; BnaA03g02860D protein
STRINGBra006055.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-162myb domain protein 92